PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013588075.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family EIL
Protein Properties Length: 583aa    MW: 65953.5 Da    PI: 5.083
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013588075.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3426.72.4e-130403981350
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     e+l++rmwkd+++lkr+ker+k      +    +++ +k +eqa+rkkmsraQDgiLkYMlk mevc+++GfvYgiipekgkpv+g+sd++raWW
  XP_013588075.1  40 EDLERRMWKDRVRLKRIKERTKID---SS--QTKETPKKVSEQAQRKKMSRAQDGILKYMLKLMEVCKVRGFVYGIIPEKGKPVSGSSDNIRAWW 129
                     89******************9963...23..3466788********************************************************* PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT- CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdq 190
                     kekv+fd+ngpaai+ky+ ++l++++++++    ++++  l++lqD+tlgSLLs+lmqhc+ppqr++plekg++pPWWP+G+e+ww +lgl k q
  XP_013588075.1 130 KEKVKFDKNGPAAIAKYEEECLAFGKSDGD----RNSQFVLQDLQDATLGSLLSSLMQHCNPPQRKYPLEKGTPPPWWPSGDEEWWVKLGLGKGQ 220
                     *************************88888....67899******************************************************** PP

                     -.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...........XXXXXXXXX CS
            EIN3 191 gtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...........slrkqspkv 274
                     + ppykkphdlkk+wkv+vLtavi+hmsp+i++i++++rqsk+lqdkm+akes+++l+vlnqee+++ + s+++            +  ++++k+
  XP_013588075.1 221 S-PPYKKPHDLKKMWKVGVLTAVINHMSPDIAKIKRHVRQSKCLQDKMTAKESAIWLAVLNQEESLIPQPSSDNGasnvtethrrgNNAERRRKT 314
                     *.9*********************************************************************944445888766665556999** PP

                     XXXXXXXXXXXXXXXXX.XXXXXXXXXX.........XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXX CS
            EIN3 275 tlsceqkedvegkkeskikhvqavktta.........gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsis 350
                     +++ ++++dv++++e + + ++++++++         + ++vr ++k +++++  + +  + + ++++ ++ e++++++d+n+++
  XP_013588075.1 315 VINGDSDYDVDVTEEASGSVSSKDNRRKqtqkeqpaaTSQTVRDQDKSEKHRRRKKPR-RTVNGEEEEQPEAEQRNVLPDMNHVD 398
                     ***********66666666666666555566666655666666666444444444444.456777777788899999***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048735.6E-12440283No hitNo description
Gene3DG3DSA:1.10.3180.104.3E-70160289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167684.18E-60164285IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MGGGDLPISV TDIRMENEPD DLASDNVAEI DVSDEEIDAE DLERRMWKDR VRLKRIKERT  60
KIDSSQTKET PKKVSEQAQR KKMSRAQDGI LKYMLKLMEV CKVRGFVYGI IPEKGKPVSG  120
SSDNIRAWWK EKVKFDKNGP AAIAKYEEEC LAFGKSDGDR NSQFVLQDLQ DATLGSLLSS  180
LMQHCNPPQR KYPLEKGTPP PWWPSGDEEW WVKLGLGKGQ SPPYKKPHDL KKMWKVGVLT  240
AVINHMSPDI AKIKRHVRQS KCLQDKMTAK ESAIWLAVLN QEESLIPQPS SDNGASNVTE  300
THRRGNNAER RRKTVINGDS DYDVDVTEEA SGSVSSKDNR RKQTQKEQPA ATSQTVRDQD  360
KSEKHRRRKK PRRTVNGEEE EQPEAEQRNV LPDMNHVDTP LLEYNINGTN HQEEGVLEPN  420
IALEPEENSL ELVIPEFNNN YTYLPPVNGQ AMIPVEERPM LYGTNTNQEL QFGSGYNFYN  480
PSAVFVHNQE EDLIHTQIEM NPQAPPHNGG FEATGGVLQP HNLLGNEDSV TGRDLPPQFQ  540
SDQDKLLDSN ILSPFSDLAF DSNTFYSGFD SYGVDDHLSW FGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A4e-811632949140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1365371RRRKKPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588075.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0D3CWU20.0A0A0D3CWU2_BRAOL; Uncharacterized protein
STRINGBra003831.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46582548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.10.0ETHYLENE-INSENSITIVE3-like 3